PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00159.1_g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 338aa    MW: 36197.8 Da    PI: 9.8869
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00159.1_g00019.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19e-3994152462
                   zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                l+cprC+s+ntkfCy+nny+l+qPr+fCkaCrryWt+GGalrnvPvGgg+r+nkk++
  Rsa1.0_00159.1_g00019.1  94 GPLNCPRCNSANTKFCYFNNYNLTQPRHFCKACRRYWTHGGALRNVPVGGGCRRNKKAK 152
                              5789****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3377147IPR003851Zinc finger, Dof-type
PfamPF027011.4E-3295150IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.68396150IPR003851Zinc finger, Dof-type
PROSITE patternPS01361098134IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MVFSSISSFL DPPINWPQSA NSNNHPNHPH QLHLQETGNL VSGHQVHSHQ FPPNPNPNHN  60
HADTTAAATG DHAGLSGSAS ERARLAKNSH PPEGPLNCPR CNSANTKFCY FNNYNLTQPR  120
HFCKACRRYW THGGALRNVP VGGGCRRNKK AKTGNSKSAS SQTKQSASMV NAPSPTNIQL  180
QTNSQLPFLP TLQNLTQLGG IGLNLAAING NSVGNSNTSS SFFNDLGFYH GANTSGSVMA  240
NNNNENNIMT SLGSASHFAM LDRSMGLYSF PNEGNMVLSS STASRVSQTA PVKREETHVG  300
SISRPVSGLT SAGNQSNQYW PGLSLPGSSS NDRQQHLM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013631774.10.0PREDICTED: dof zinc finger protein DOF2.2 isoform X1
SwissprotQ9ZV331e-168DOF22_ARATH; Dof zinc finger protein DOF2.2
TrEMBLA0A0D3C2Q40.0A0A0D3C2Q4_BRAOL; Uncharacterized protein
STRINGBra035667.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.11e-132Dof family protein